Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRL FFKNVTGHYISPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPR WTNAKMEIATKEPMNPIKQYVKDGKLRYVANIFPYKGYIWNYGTLPQTWE DPHEKDKSTNCFGDNDPIDVCEIGSKILSCGEVIHVKILGILALIDEGET DWKLIAINANDPEASKFHDIDDVKKFKPGYLEATLNWFRLYKVPDGKPEN QFAFNGEFKNKAFALEVIKSTHQCWKALLMKKCNGGAINCTNVQISDSPF RCTQEEARSLVESVSSSPNKESNEEEQVWHFLGK
    • Amino acids
      1 to 334
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HSPC124
    • Inorganic pyrophosphatase 2
    • Inorganic pyrophosphatase 2, mitochondrial
    • IPYR2_HUMAN
    • mitochondrial
    • Ppa2
    • PPase 2
    • PPase2
    • Pyrophosphatase (inorganic) 2
    • Pyrophosphatase SID6 306
    • Pyrophosphatase SID6-306
    • Pyrophosphate phospho-hydrolase 2
    • SID6 306
    see all
  • Tissue specificity
    Detected in brain, gastric carcinoma, lung, ovary, skeletal muscle, umbilical cord blood and a cell line derived from kidney proximal tubule epithelium.
  • Sequence similarities
    Belongs to the PPase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab162066 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up