Recombinant Human PPAPDC1B protein (ab164601)

Overview

  • Product name
    Recombinant Human PPAPDC1B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWLYRNPYVEAEYFPTKPMFVIAFLSPLSLIFLAKFLKKADTRDSRQACL AASLALALNGVFTNTIKLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDVV NEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRFCAFLSP LLFAAVIALSRTCDYKHHWQGPFKW
    • Amino acids
      1 to 175
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • diacylglycerol pyrophosphate like 1
    • Diacylglycerol pyrophosphate phosphatase like 1
    • DPPL1
    • EC=3.1.3.4
    • HTPAP
    • Phosphatidate phosphatase PPAPDC1B
    • Phosphatidic acid phosphatase type 2 domain containing 1B
    • Phosphatidic acid phosphatase type 2 domain-containing protein 1B
    • Phospholipid phosphatase 5
    • PPAPDC1B
    • PPC1B_HUMAN
    • Testicular secretory protein Li 38
    see all
  • Function
    Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol. May be a metastatic suppressor for hepatocellular carcinoma.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the PA-phosphatase related phosphoesterase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164601 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up