Recombinant Human PPAR alpha protein (ab81925)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ07869
    • SpeciesHuman
    • SequenceMVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFG FTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNI ECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNR NKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSET ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMA EKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLR KPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIE KMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIK KTESDAALHPLLQEIYRDMY
    • Amino acids1 to 468

Specifications

Our Abpromise guarantee covers the use of ab81925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity1 unit equals 1 nanogram of purified protein.
  • Applications

    SDS-PAGE

    EMSA

  • Purity> 95 % SDS-PAGE.

  • FormLiquid
  • Additional notes1 unit equals 1 nanogram of purified protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Potassium chloride, 1mM DTT, 0.2mM EDTA, pH 8.0

General Info

  • Alternative names
    • hPPAR
    • MGC2237
    • MGC2452
    • NR1C1
    • Nuclear receptor subfamily 1 group C member 1
    • OTTHUMP00000197740
    • OTTHUMP00000197741
    • Peroxisome proliferative activated receptor alpha
    • Peroxisome proliferator activated receptor alpha
    • Peroxisome proliferator-activated receptor alpha
    • PPAR
    • PPAR-alpha
    • ppara
    • PPARA_HUMAN
    • PPARalpha
    see all
  • FunctionLigand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety (By similarity). Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2.
  • Tissue specificitySkeletal muscle, liver, heart and kidney.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

References for Recombinant Human PPAR alpha protein (ab81925)

ab81925 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"