Recombinant Human PPAR gamma protein (ab53382)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHY EDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHE EPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDL NCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSD IDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIY DMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYA KSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGL LNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHV QLLQVIKKTETDMSLHPLLQEIYKDLY
    • Molecular weight59 kDa

Specifications

Our Abpromise guarantee covers the use of ab53382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 50% Glycerol, 20mM Tris, pH 8

General Info

  • Alternative names
    • CIMT1
    • GLM1
    • NR1C3
    • Nuclear receptor subfamily 1 group C member 3
    • OTTHUMP00000185032
    • OTTHUMP00000185036
    • Peroxisome proliferator activated nuclear receptor gamma variant 1
    • Peroxisome Proliferator Activated Receptor gamma
    • Peroxisome proliferator activated receptor gamma 1
    • Peroxisome proliferator-activated receptor gamma
    • PPAR gamma
    • PPAR-gamma
    • PPARG
    • PPARG_HUMAN
    • PPARG1
    • PPARG2
    • PPARgamma
    see all
  • FunctionReceptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-CoA oxidase and activates its transcription. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis.
  • Tissue specificityHighest expression in adipose tissue. Lower in skeletal muscle, spleen, heart and liver. Also detectable in placenta, lung and ovary.
  • Involvement in diseaseNote=Defects in PPARG can lead to type 2 insulin-resistant diabetes and hyptertension. PPARG mutations may be associated with colon cancer.
    Defects in PPARG may be associated with susceptibility to obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
    Defects in PPARG are the cause of familial partial lipodystrophy type 3 (FPLD3) [MIM:604367]. Familial partial lipodystrophies (FPLD) are a heterogeneous group of genetic disorders characterized by marked loss of subcutaneous (sc) fat from the extremities. Affected individuals show an increased preponderance of insulin resistance, diabetes mellitus and dyslipidemia.
    Genetic variations in PPARG can be associated with susceptibility to glioma type 1 (GLM1) [MIM:137800]. Gliomas are central nervous system neoplasms derived from glial cells and comprise astrocytomas, glioblastoma multiforme, oligodendrogliomas, and ependymomas. Note=Polymorphic PPARG alleles have been found to be significantly over-represented among a cohort of American patients with sporadic glioblastoma multiforme suggesting a possible contribution to disease susceptibility.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human PPAR gamma protein images

  • SDS Page analysis of ab53382

References for Recombinant Human PPAR gamma protein (ab53382)

ab53382 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry. we currently produce isoform 1. The accession number for the DNA sequence is NM_005037 and NP_005028 for the protein. It is possible that the accession numbers have been replaced in the NBCI database as this happens from ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"