Overview

  • Product nameRecombinant Human PPCS protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9HAB8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAEMDPVAEFPQPPGAARWAEVMARFAARL GAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGV LFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAE ALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAA VSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISF KLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLL SEEEIEKGVEIEEKIVDNLQSRHTAFIGDRN
    • Molecular weight36 kDa including tags
    • Amino acids1 to 331
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    Purified by using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • COAB
    • FLJ11838
    • MGC117357
    • MGC138220
    • OTTHUMP00000008433
    • Phosphopantothenate--cysteine ligase
    • Phosphopantothenoylcysteine synthetase
    • PPC synthetase
    • Ppcs
    • PPCS_HUMAN
    • RP11-163G10.1
    see all
  • FunctionCatalyzes the first step in the biosynthesis of coenzyme A from vitamin B5, where cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine.
  • PathwayCofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 2/5.
  • Sequence similaritiesBelongs to the PPC synthetase family.
  • Information by UniProt

Recombinant Human PPCS protein images

  • ab107145 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human PPCS protein (ab107145)

ab107145 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"