Recombinant Human PPFIBP2 protein (ab160052)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPV LHLIEDLRLALEMLELPQERAALLSQIPGPTAAYIKEWFEESLSQVNHHS AASNETYQERLARLEGDKESLILQVSVITDQVEAQGEKIRDLEVCLEGHQ VKLNAAEEMLQQELLSRTSLETQKLDLMTEVSELKLKLVGMEKEQREQEE KQRKAEELLQELRHLKIKVEELENERNQYEWKLKATKAEVAQLQEQVALK DAEIERLHSQLSRTAALHSESHTERDQEIQRLKMGMETLLLANEDKDRRI EELTGLLNQYRKVKEIVMVTQGPSERTLSINEEEPEGGFSKWNATNKDPE ELFKQEMPPRCSSPTVGPPPLPQKSLETRAQKKLSCSLEDLRSESVDKCM DGNQPFPVLEPKDSPFLAEHKYPTLPGKLSGATPNGEAAKSPPTICQPDA TGSSLLRLRDTESGWDDTAVVNDLSSTSSGTESGPQSPLTPDGKRNPKGI KKFWGKIRRTQSGNFYTDTLGMAEFRRGGLRATAGPRLSRTRDSKGQKSD ANAPFAQWSTERVCAWLEDFGLAQYVIFARQWVSSGHTLLTATPQDMEKE LGIKHPLHRKKLVLAVKAINTKQEEKSALLDHIWVTRWLDDIGLPQYKDQ FHESRVDGRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPHCL HRRPADESNLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLII LEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKREKMASP AYTPLTTTAKVRPRKLGFSHFGNIRKKKFDESTDYICPMEPSDGVSDSHR VYSGYRGLSPLDAPELDGLDQVGQIS
    • Amino acids
      1 to 876
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Binding protein 2
    • Cclp 1
    • Cclp1
    • DKFZp781K06126
    • LIPB2_HUMAN
    • Liprin beta 2
    • Liprin-beta-2
    • MGC42541
    • PPFIBP 2
    • Ppfibp2
    • Protein tyrosine phosphatase receptor type f polypeptide interacting protein binding protein 2
    • Protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 2
    • PTPRF interacting protein binding protein 2
    • PTPRF interacting protein binding protein 2 (liprin beta 2)
    • PTPRF-interacting protein-binding protein 2
    see all
  • Function
    May regulate the disassembly of focal adhesions. Did not bind receptor-like tyrosine phosphatases type 2A.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the liprin family. Liprin-beta subfamily.
    Contains 3 SAM (sterile alpha motif) domains.
  • Domain
    The N-terminal coiled coil regions mediate homodimerization preferentially and heterodimerization type beta/beta. The C-terminal, non-coiled coil regions mediate heterodimerization type beta/alpha.
  • Information by UniProt

Images

  • ab160052 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up