Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ13427
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGIKVQRPRCFFDIAINNQPAGRVVFELFS DVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFS EGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKP TPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCG
    • Molecular weight22 kDa including tags
    • Amino acids1 to 175
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 75 nmoles/min/ug, and is defined as the amount of enzyme that will cleave 1umole of suc-AAFP-pNA per minute at 1C in Tris-Hcl pH8.0 using chymotrypsin.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % SDS-PAGE.
    ab117666 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesAlthough stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.24% Tris, 0.02% DTT, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CARS cyclophilin
    • CARS Cyp
    • CARS-cyclophilin
    • CARS-Cyp
    • CASP 10
    • CASP10
    • Clk associating RS cyclophilin
    • Clk-associating RS-cyclophilin
    • Cyclophilin G
    • CyclophilinG
    • CYP
    • MGC133241
    • Peptidyl prolyl cis trans isomerase G
    • Peptidyl prolyl isomerase G
    • Peptidyl-prolyl cis-trans isomerase G
    • Peptidyl-prolyl isomerase G
    • Peptidylprolyl isomerase G
    • Peptidylprolyl isomerase G (cyclophilin G)
    • PPIase G
    • Ppig
    • PPIG_HUMAN
    • Rotamase G
    • RotamaseG
    • SCAF10
    • SR cyclophilin
    • SR cyp
    • SR related CTD associated factor 10
    • SR-cyclophilin
    • SR-cyp
    • SRcyp
    see all
  • FunctionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be implicated in the folding, transport, and assembly of proteins. May play an important role in the regulation of pre-mRNA splicing.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesContains 1 PPIase cyclophilin-type domain.
  • DomainThe RS domain is required for the interaction with the phosphorylated C-terminal domain of RNA polymerase II.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus matrix. Nucleus speckle. Colocalizes with RNA splicing factors at nuclear speckles.
  • Information by UniProt

References for Recombinant human PPIG protein (ab117666)

ab117666 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"