Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGE FRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENF KLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLV MRKIENVPTGPNNKPKLPVVISQCGEM

Associated products

Specifications

Our Abpromise guarantee covers the use of ab78874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 220 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant Cyclophikin H (PPIH) protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level< 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab78874 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, PBS, pH 7.4

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Cyclophilin H
    • CYP-20
    • CypH
    • Peptidyl prolyl cis trans isomerase H
    • Peptidyl-prolyl cis-trans isomerase H
    • Peptidylprolyl isomerase H
    • PPIase H
    • PPIH
    • PPIH_HUMAN
    • RGD1564921
    • Rotamase H
    • Small nuclear ribonucleoprotein particle specific cyclophilin H
    • Small nuclear ribonucleoprotein particle-specific cyclophilin H
    • SnuCyp 20
    • U snRNP associated cyclophilin SnuCyp 20
    • U-snRNP-associated cyclophilin SnuCyp-20
    • USA CYP
    • USA-CYP
    • USACYP
    see all
  • FunctionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex. May act as a chaperone.
  • Sequence similaritiesBelongs to the cyclophilin-type PPIase family. PPIase H subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localizationNucleus speckle. Cytoplasm. Colocalizes with spliceosomal snRNPs. A small proportion may also be cytoplasmic.
  • Information by UniProt

Recombinant human PPIH protein images

  • 15% SDS-PAGE showing ab78874 at approximately 19kDa (3µg).

References for Recombinant human PPIH protein (ab78874)

ab78874 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab78874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"