Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9H2H8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSVTLHTDVGDIKIEVFCERTPKTCENFLA LCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDE LEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
    • Molecular weight20 kDa including tags
    • Amino acids1 to 161
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 280 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant PPIL3 protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    Mass Spectrometry

    Functional Studies

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113119 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 2310076N22Rik
    • 2510026K04Rik
    • Ccyclophilin like protein
    • Cyclophilin J
    • Cyclophilin like 3
    • Cyclophilin like protein 3
    • Cyclophilin like protein PPIL3
    • Cyclophilin-like protein PPIL3
    • Cyp10l
    • CyPJ
    • MGC105285
    • Peptidyl prolyl cis trans isomerase like 3
    • Peptidyl-prolyl cis-trans isomerase-like 3
    • Peptidylprolyl cis trans isomerase like protein 3
    • Peptidylprolyl isomerase (cyclophilin) like 3
    • Peptidylprolyl isomerase like 3
    • PPIase
    • PPIase like protein 3
    • Ppil3
    • PPIL3_HUMAN
    • Rotamase
    • Rotamase PPIL3
    see all
  • FunctionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.
  • Tissue specificityUbiquitous. Detected at low levels.
  • Sequence similaritiesBelongs to the cyclophilin-type PPIase family. PPIL3 subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Information by UniProt

Recombinant human PPIL3 protein images

  • 15% SDS-PAGE analysis of ab113119 (3µg)

References for Recombinant human PPIL3 protein (ab113119)

ab113119 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"