Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAVLLETTLGDVVIDLYTEERPRACLNFLK LCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQASFFEA EKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVT EGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPE PTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDL PDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGES LCYAFIEFEKEEDCEKAFFKMDNVLIDDRRIHVDFSQSVAKVKWKGKGGK YTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSKSSHSH TSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQ KSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSP KKSKDKEKSKYR
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 512
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 190 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant PPIL4 protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1µC and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.

    Specific activity is > 190 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

     

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab101207 was purified using conventional chromatography and is >85 % pure by SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Cyclophilin type peptidyl prolyl cis trans isomerase
    • Cyclophilin-like protein PPIL4
    • HDCME13P
    • Peptidyl-prolyl cis-trans isomerase-like 4
    • Peptidylprolyl isomerase (cyclophilin) like 4
    • Peptidylprolyl Isomerase Like 4
    • PPIase
    • Ppil4
    • PPIL4_HUMAN
    • Rotamase
    • Rotamase PPIL4
    • serologically defined breast cancer antigen NY-BR-18
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificity
    Abundantly expressed in kidney but has a ubiquitously low expression pattern in other adult tissues.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family. PPIL4 subfamily.
    Contains 1 PPIase cyclophilin-type domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab101207 (3 µg) analysed by 15% SDS PAGE.
    Molecular size on SDS-PAGE will appear higher than the predicted molecular weight of 59.4 kDa.

References

ab101207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up