Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGP LMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLL HQHRKTVCVC
    • Amino acids
      496 to 605
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.1.3.16
    • p53 induced protein phosphatase 1
    • p53-induced protein phosphatase 1
    • PP2C delta
    • PP2C-delta
    • PP2CD
    • Ppm1d
    • PPM1D_HUMAN
    • Protein phosphatase 1D
    • protein phosphatase 1D magnesium-dependent delta isoform
    • Protein phosphatase 2C delta isoform
    • Protein phosphatase 2C isoform delta
    • Protein phosphatase magnesium dependent 1 delta
    • Protein phosphatase magnesium-dependent 1 delta
    • Protein phosphatase Mg2+/Mn2+ dependent 1D
    • Protein phosphatase Wip1
    • Wild type p53 induced phosphatase 1
    • WIP 1
    • WIP1
    see all
  • Function
    Required for the relief of p53-dependent checkpoint mediated cell cycle arrest. Binds to and dephosphorylates 'Ser-15' of TP53 and 'Ser-345' of CHEK1 which contributes to the functional inactivation of these proteins.
  • Sequence similarities
    Belongs to the PP2C family.
    Contains 1 PP2C-like domain.
  • Information by UniProt

Images

  • ab160051 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up