Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSSGAPQKSSPMASGAEETPGFLDTLL QDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAA ALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEEKAPVTLLDAQSLAQ SFFNRLWEVAGQWQKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLP SFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTDP EGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQV ILVQQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRA IGDVFQKPYVSGEADAASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQS HLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGE GDPQAEGRRQDLPSSLPEPETQAPPRS
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 454
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171704 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab171704 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Ca(2+)/calmodulin-dependent protein kinase phosphatase
    • CaM-kinase phosphatase
    • CAMKP
    • CaMKPase
    • FEM 2
    • hFEM-2
    • KIAA0015
    • Partner of PIX 2
    • POPX2
    • PP2C phosphatase
    • Ppm1f
    • PPM1F_HUMAN
    • Protein fem-2 homolog
    • Protein phosphatase 1F
    • Protein phosphatase 1F (PP2C domain containing)
    • Protein phosphatase Mg2+/Mn2+ dependent 1F
    see all
  • Function
    Dephosphorylates and concomitantly deactivates CaM-kinase II activated upon autophosphorylation, and CaM-kinases IV and I activated upon phosphorylation by CaM-kinase kinase. Promotes apoptosis.
  • Sequence similarities
    Belongs to the PP2C family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171704 (3µg).

References

ab171704 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171704.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up