Recombinant human PPM1G protein (ab109936)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGAYLSQPNTVKCSGDGVGAPRLPLPYGFS AMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIK DQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEK VADEDDVDNEEAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEE PGSQGLNGEAGPEDSTRETPSQENGPTAKAYTGFSSNSERGTEAGQVGEP GIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEE EDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGTT AVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNA GGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLT DDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELL DQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEG AEENGNSDKKKKAKRD
    • Molecular weight
      61 kDa including tags
    • Amino acids
      1 to 546
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity: >3,000 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme hydrolyzing 1 nmole of p-nitrophenyl phosphate (pNPP) per minute at 37°C, pH 7.5 using 10mM of substrate.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab109936 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • MGC1675
    • MGC2870
    • OTTHUMP00000123426
    • PP2C
    • PP2C gamma
    • PP2C-gamma
    • PP2CG
    • PP2Cgamma
    • PPM1G
    • PPM1G_HUMAN
    • PPP2CG
    • Protein phosphatase 1C
    • Protein phosphatase 1G
    • Protein phosphatase 2 catalytic subunit gamma isoform
    • Protein phosphatase 2C gamma isoform
    • Protein phosphatase 2C isoform gamma
    • Protein phosphatase magnesium dependent 1 gamma
    • Protein phosphatase magnesium-dependent 1 gamma
    • Protein phosphatase Mg2+/Mn2+ dependent 1G
    see all
  • Tissue specificity
    Widely expressed. Most abundant in testis, skeletal muscle, and heart.
  • Sequence similarities
    Belongs to the PP2C family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109936 (3µg).

References

ab109936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Here is the assay protocolused to assess protein activityfor ab109936:

1. Prepare a 200ul reaction mix into a suitable container : The final concentrations are 10mM Tris(pH7.5), 50mM NaCl, 2mM DTT, 1mM MnCl2, 10mM pNPP.
2. Pre-warm react...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up