Recombinant human PPM1G protein (ab109936)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGAYLSQPNTVKCSGDGVGAPRLPLPYGFS AMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIK DQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEK VADEDDVDNEEAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEE PGSQGLNGEAGPEDSTRETPSQENGPTAKAYTGFSSNSERGTEAGQVGEP GIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEE EDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGTT AVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNA GGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLT DDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELL DQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEG AEENGNSDKKKKAKRD
    • Molecular weight
      61 kDa including tags
    • Amino acids
      1 to 546
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity: >3,000 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme hydrolyzing 1 nmole of p-nitrophenyl phosphate (pNPP) per minute at 37°C, pH 7.5 using 10mM of substrate.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab109936 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • MGC1675
    • MGC2870
    • OTTHUMP00000123426
    • PP2C
    • PP2C gamma
    • PP2C-gamma
    • PP2CG
    • PP2Cgamma
    • PPM1G
    • PPM1G_HUMAN
    • PPP2CG
    • Protein phosphatase 1C
    • Protein phosphatase 1G
    • Protein phosphatase 2 catalytic subunit gamma isoform
    • Protein phosphatase 2C gamma isoform
    • Protein phosphatase 2C isoform gamma
    • Protein phosphatase magnesium dependent 1 gamma
    • Protein phosphatase magnesium-dependent 1 gamma
    • Protein phosphatase Mg2+/Mn2+ dependent 1G
    see all
  • Tissue specificity
    Widely expressed. Most abundant in testis, skeletal muscle, and heart.
  • Sequence similarities
    Belongs to the PP2C family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant human PPM1G protein images

  • 15% SDS-PAGE showing ab109936 (3µg).

References for Recombinant human PPM1G protein (ab109936)

ab109936 has not yet been referenced specifically in any publications.

Product Wall

Here is the assay protocolused to assess protein activityfor ab109936:

1. Prepare a 200ul reaction mix into a suitable container : The final concentrations are 10mM Tris(pH7.5), 50mM NaCl, 2mM DTT, 1mM MnCl2, 10mM pNPP.
2. Pre-warm react...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up