Overview

  • Product name
    Recombinant Human PPM1K protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRF DPDGSGSPATWDNFGIWDNRIDEPILLPPSIKYGKPIPKISLEKVGCASQ IGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHTHMEKCIMDLL PKEKNLETLLTLAFLEIDKAFSSHARLSADATLLTSGTTATVALLRDGIE LVVASVGDSRAILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLG QPHVNGRLAMTRSIGDLDLKTSGVIAEPETKRIKLHHADDSFLVLTTDGI NFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWG KYKNSEINFSFSRSFASSGRWA
    • Amino acids
      1 to 372
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BDP
    • mitochondrial
    • MSUDMV
    • PP2C domain containing protein phosphatase 1K
    • PP2C domain-containing protein phosphatase 1K
    • PP2C kappa
    • PP2C like mitochondrial protein
    • PP2C type mitochondrial phosphoprotein phosphatase
    • PP2C-kappa
    • PP2C-like mitochondrial protein
    • PP2C-type mitochondrial phosphoprotein phosphatase
    • PP2Ckappa
    • PP2CM
    • PPM1K
    • PPM1K_HUMAN
    • Protein phosphatase 1K
    • Protein phosphatase 1K, mitochondrial
    • Protein phosphatase 2C isoform kappa
    • Protein phosphatase Mg2+/Mn2+ dependent 1K
    • PTMP
    • UG0882E07
    see all
  • Function
    Regulates the mitochondrial permeability transition pore and is essential for cellular survival and development.
  • Sequence similarities
    Belongs to the PP2C family.
    Contains 1 PP2C-like domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab165655 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up