Overview

  • Product name
    Recombinant Human PPM1L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVK SSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKNHNVAVYSIQG RRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQH LQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALL SDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFIS FNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILA SDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVK FRNSSKTEEQ
    • Amino acids
      1 to 360
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.1.3.16
    • in phosphatase 1 (formerly 2C) like
    • MGC132545
    • MGC132547
    • OTTHUMP00000213920
    • OTTHUMP00000213921
    • PP2C epsilon
    • PP2C-epsilon
    • PP2CE
    • PPM1 like
    • PPM1-LIKE
    • PPM1L
    • PPM1L_HUMAN
    • Protein phosphatase 1 (formerly 2C)-like
    • Protein phosphatase 1 like
    • Protein phosphatase 1-like
    • Protein phosphatase 1L
    • Protein phosphatase 2C epsilon isoform
    • Protein phosphatase 2C isoform epsilon
    • Protein phosphatase, Mg2+/Mn2+ dependent, 1L
    see all
  • Function
    Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6.
  • Tissue specificity
    Ubiquitous. Highly expressed in heart, placenta, lung, liver, kidney and pancreas.
  • Sequence similarities
    Belongs to the PP2C family.
    Contains 1 PP2C-like domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165634 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up