Recombinant Human PPP1R16B protein (ab161884)

Overview

  • Product name
    Recombinant Human PPP1R16B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRK HERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNED GLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLV KILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEM RVAPEQQMIADIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLD HGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPID LCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRAS LSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNP RLEKPVLLSEFPTKIPRGELDMPVENGLRAPVSAYQYALANGDVWKVHEV PDYSMAYGNPGVADATPPWSSYKEQSPQTLLELKRQRAAAKLLSHPFLST HLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFK APIEEMEEKVHGCCRIS
    • Amino acids
      1 to 567
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANKRD4
    • Ankyrin repeat domain containing protein 4
    • ankyrin repeat domain protein 4
    • Ankyrin repeat domain-containing protein 4
    • CAAX box protein TIMAP
    • hTIMAP
    • KIAA0823
    • PP16B_HUMAN
    • PPP1R16B
    • Protein phosphatase 1 regulatory inhibitor subunit 16B
    • protein phosphatase 1, regulatory (inhibitor) subunit 16B
    • TGF beta inhibited membrane associated protein
    • TGF-beta-inhibited membrane-associated protein
    • TIMAP
    see all
  • Function
    Regulator of protein phosphatase 1 (PP1) that acts as a positive regulator of pulmonary endothelial cell (EC) barrier function. Involved in PKA-mediated moesin dephosphorylation which is important in EC barrier protection against thrombin stimulation. Promotes the interaction of PPP1CA with RPSA/LAMR1 and in turn facilitates the dephosphorylation of RPSA/LAMR1. Involved in the regulation of endothelial cell filopodia extension. May be a downstream target for TGF-beta1 signaling cascade in endothelial cells.
  • Tissue specificity
    Highly expressed in vascular endothelium, CNS, lung, spleen, kidney and testis.
  • Sequence similarities
    Contains 5 ANK repeats.
  • Post-translational
    modifications
    Phosphorylated by PKA and, after PKA priming, by GSK3B. Phosphorylation by GSK3B reduces its association with PP1C and enhances PP1C activity. Dephosphorylation by its associated PP1C results in enhanced association with PP1C, but reduced PP1C activity.
  • Cellular localization
    Cell membrane. Cell membrane. Nucleus. Co-localizes with RPSA/LAMR1 in the cell membrane.
  • Information by UniProt

Images

  • ab161884 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up