Recombinant Human PPP1R3A protein (ab116962)

Overview

  • Product name
    Recombinant Human PPP1R3A protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDI YLDTPSSGTRRVSFADSFGFNLVSVKEFDCWELPSASTTFDLGTDIFHT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      3 to 101

Specifications

Our Abpromise guarantee covers the use of ab116962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle
    • Glycogen associated regulatory subunit of protein phosphatase 1
    • GM
    • PP1G
    • PPP1R3
    • PPP1R3A
    • PPR3A_HUMAN
    • Protein phosphatase 1 glycogen-associated regulatory subunit
    • Protein phosphatase 1 glycogen-targeting subunit, muscle
    • Protein phosphatase 1 regulatory subunit 3A
    • Protein phosphatase 1 regulatory subunit GM
    • protein phosphatase 1, regulatory (inhibitor) subunit 3A
    • Protein phosphatase 1, regulatory subunit 3
    • Protein phosphatase type-1 glycogen targeting subunit
    • RG1
    • Serine /threonine specific protein phosphatase
    • Type 1 protein phosphatase skeletal muscle glycogen targeting subunit
    see all
  • Function
    Seems to act as a glycogen-targeting subunit for PP1. PP1 is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Plays an important role in glycogen synthesis but is not essential for insulin activation of glycogen synthase.
  • Tissue specificity
    Skeletal muscle and heart.
  • Involvement in disease
    Diabetes mellitus, non-insulin-dependent
  • Sequence similarities
    Contains 1 CBM21 (carbohydrate binding type-21) domain.
  • Domain
    The CBM21 domain is known to be involved in the localization to glycogen and is characteristic of some regulatory subunit of phosphatase complexes.
  • Post-translational
    modifications
    Phosphorylation at Ser-46 by ISPK stimulates the dephosphorylation of glycogen synthase and phosphorylase kinase.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116962 at approximately 36.52kDa stained with Coomassie Blue.

References

ab116962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up