Recombinant Human PPP1R3B protein (ab164065)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMV APAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIV SLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVK VQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPE KIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGP DLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY
    • Amino acids
      1 to 285
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ14005
    • FLJ34675
    • GL
    • Hepatic glycogen targeting protein phosphatase 1 regulatory subunit GL
    • Hepatic glycogen targeting subunit G(L)
    • Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL
    • PP1 subunit R4
    • Ppp1r3b
    • PPP1R4
    • PPR3B_HUMAN
    • Protein phosphatase 1 regulatory (inhibitor) subunit 3B
    • Protein phosphatase 1 regulatory subunit 3B
    • Protein phosphatase 1 regulatory subunit 4
    • Protein phosphatase 1 subunit 4
    • Protein phosphatase 1 subunit GL
    • PTG
    • R4
    see all
  • Function
    Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes.
  • Tissue specificity
    Highly expressed in liver. Expressed moderately in skeletal muscle and myotubes (at protein level). Expressed predominantly in heart and skeletal muscle. Expressed moderately in liver. Expressed weakly in placenta, lung and kidney.
  • Sequence similarities
    Contains 1 CBM21 (carbohydrate binding type-21) domain.
  • Domain
    The N-terminal region is required for binding to PP1, the central region is required for binding to glycogen and the C-terminal region is required for binding to PYGL.
  • Information by UniProt

Images

  • ab164065 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up