Recombinant Human PPP2CB protein (ab114425)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP62714
    • SpeciesHuman
    • SequenceMDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRC PVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLL VALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLF DYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLW SDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNW CHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV TRRTPDYFL
    • Molecular weight60 kDa including tags
    • Amino acids1 to 309

Specifications

Our Abpromise guarantee covers the use of ab114425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PP2A beta
    • PP2A-beta
    • PP2AB_HUMAN
    • PP2Abeta
    • PP2CB
    • Ppp2cb
    • Protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform
    • Protein phosphatase 2 catalytic subunit beta isozyme
    • Protein phosphatase 2, catalytic subunit, beta isoform
    • Protein phosphatase 2A catalytic subunit beta isoform
    • Protein phosphatase type 2A catalytic subunit
    • Serine/threonine protein phosphatase 2A catalytic subunit beta
    • Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
    see all
  • FunctionPP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.
  • Sequence similaritiesBelongs to the PPP phosphatase family. PP-1 subfamily.
  • Post-translational
    modifications
    Reversibly methyl esterified on Leu-309. Carboxyl methylation may play a role in holoenzyme assembly. It varies during the cell cycle. Demethylated by PME1 (in vitro).
    Phosphorylation of either threonine (by autophosphorylation-activated protein kinase) or tyrosine results in inactivation of the phosphatase. Auto-dephosphorylation has been suggested as a mechanism for reactivation.
  • Cellular localizationCytoplasm. Nucleus. Chromosome > centromere. Cytoplasm > cytoskeleton > spindle pole. In prometaphase cells, but not in anaphase cells, localizes at centromeres. During mitosis, also found at spindle poles.
  • Information by UniProt

Recombinant Human PPP2CB protein images

  • ab114425 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human PPP2CB protein (ab114425)

ab114425 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"