Recombinant Human PPP2R1B protein (ab114892)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTI ALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHC LLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASG DWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASK LGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQD DLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQ NLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTN QHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNL DCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEF FDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLV MANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRF NVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL A
    • Molecular weight
      92 kDa including tags
    • Amino acids
      1 to 601

Specifications

Our Abpromise guarantee covers the use of ab114892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2AAB_HUMAN
    • beta isoform of regulatory subunit A, protein phosphatase 2
    • PP2A A beta
    • PP2A subunit A isoform PR65-beta
    • PP2A subunit A isoform R1-beta
    • PP2A, subunit A, PR65 beta isoform
    • PP2A, subunit A, R1 beta isoform
    • PPP2R1B
    • PPP4R1
    • PR65B
    • protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform
    • protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform
    • Protein phosphatase 2, regulatory subunit A, beta
    • Protein phosphatase 2, structural/regulatory subunit A, beta
    • protein phosphatase 2, structural/regulatory subunit A, beta isoform
    • serine/threonine protein phosphatase 2A 65 kDa regulatory subunit A, beta isoform
    • serine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, beta isoform
    • Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
    see all
  • Function
    The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.
  • Sequence similarities
    Belongs to the phosphatase 2A regulatory subunit A family.
    Contains 15 HEAT repeats.
  • Domain
    Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114892 at approximately 92.18kDa.
    Stained with Coomassie Blue.

References

ab114892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up