Recombinant Human PPP2R1B protein (ab114892)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP30154
    • SpeciesHuman
    • SequenceMAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTI ALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHC LLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASG DWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASK LGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQD DLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQ NLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTN QHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNL DCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEF FDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLV MANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRF NVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL A
    • Molecular weight92 kDa including tags
    • Amino acids1 to 601

Specifications

Our Abpromise guarantee covers the use of ab114892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2AAB_HUMAN
    • beta isoform of regulatory subunit A, protein phosphatase 2
    • PP2A A beta
    • PP2A subunit A isoform PR65-beta
    • PP2A subunit A isoform R1-beta
    • PP2A, subunit A, PR65 beta isoform
    • PP2A, subunit A, R1 beta isoform
    • PPP2R1B
    • PPP4R1
    • PR65B
    • protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform
    • protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform
    • Protein phosphatase 2, regulatory subunit A, beta
    • Protein phosphatase 2, structural/regulatory subunit A, beta
    • protein phosphatase 2, structural/regulatory subunit A, beta isoform
    • serine/threonine protein phosphatase 2A 65 kDa regulatory subunit A, beta isoform
    • serine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, beta isoform
    • Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
    see all
  • FunctionThe PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.
  • Sequence similaritiesBelongs to the phosphatase 2A regulatory subunit A family.
    Contains 15 HEAT repeats.
  • DomainEach HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure.
  • Information by UniProt

Recombinant Human PPP2R1B protein images

  • 12.5% SDS-PAGE showing ab114892 at approximately 92.18kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PPP2R1B protein (ab114892)

ab114892 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"