Recombinant Human PPP2R2C protein (ab114748)

Overview

  • Product nameRecombinant Human PPP2R2C protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9Y2T4
    • SpeciesHuman
    • SequenceMGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVI FQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQ QNAAHSLLST
    • Molecular weight38 kDa including tags
    • Amino acids1 to 110

Specifications

Our Abpromise guarantee covers the use of ab114748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2ABG_HUMAN
    • B55 gamma
    • Gamma isoform of regulatory subunit B55 protein phosphatase 2
    • IMYPNO
    • IMYPNO 1
    • IMYPNO1
    • MGC33570
    • OTTHUMP00000115505
    • Phosphoprotein phosphatase 2A BR gamma regulatory chain
    • PP2A subunit B B gamma isoform
    • PP2A subunit B B55 gamma isoform
    • PP2A subunit B isoform B55-gamma
    • PP2A subunit B isoform gamma
    • PP2A subunit B isoform PR55-gamma
    • PP2A subunit B isoform R2-gamma
    • PP2A subunit B PR55 gamma isoform
    • PP2A subunit B R2 gamma isoform
    • PPP2R2C
    • PPP2R2C protein
    • PR 52
    • PR 55G
    • PR52
    • PR55G
    • Protein phosphatase 2 (formerly 2A) regulatory subunit B gamma isoform
    • Protein phosphatase 2 regulatory subunit B gamma
    • Protein phosphatase 2 regulatory subunit B gamma isoform
    • Protein phosphatase 2A1 B gamma subunit
    • Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
    • Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
    see all
  • FunctionThe B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Sequence similaritiesBelongs to the phosphatase 2A regulatory subunit B family.
    Contains 7 WD repeats.
  • Information by UniProt

Recombinant Human PPP2R2C protein images

  • 12.5% SDS-PAGE showing ab114748 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PPP2R2C protein (ab114748)

ab114748 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"