Recombinant Human PPP2R2D protein (ab163251)

Overview

  • Product name
    Recombinant Human PPP2R2D protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDLMVEASPRRIFANAHTYHINSISVNSDHETYLSADDLRINLWHLEITD RSFNIVDIKPANMEELTEVITAAEFHPHQCNVFVYSSSKGTIRLCDMRSS ALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFSHSGRYMMTRDYLSVK VWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSAIMT GSYNNFFRMFDRDTRRDVTLEASRESSKPRASLKPRKVCTGGKRRKDEIS VDSLDFNKKILHTAWHPVDNVIAVAATNNLYIFQDKIN
    • Amino acids
      1 to 288
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2ABD_HUMAN
    • PP2A subunit B isoform B55-delta
    • PP2A subunit B isoform delta
    • PP2A subunit B isoform PR55-delta
    • PP2A subunit B isoform R2-delta
    • PPP2R2D
    • Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
    see all
  • Function
    B regulatory subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. The activity of PP2A complexes containing PPP2R2D (PR55-delta) fluctuate during the cell cycle: the activity is high in interphase and low in mitosis. During mitosis, activity of PP2A is inhibited via interaction with phosphorylated ENSA and ARPP19 inhibitors. Within the PP2A complexes, the B regulatory subunits modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Sequence similarities
    Belongs to the phosphatase 2A regulatory subunit B family.
    Contains 7 WD repeats.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163251 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up