Recombinant Human PPP2R3B protein (ab162160)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCM DLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTE GKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELS DWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPF FEAPSPLGAVDLYEYACGDEDLEPL
    • Amino acids
      1 to 225
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NY REN 8
    • NY REN 8 antigen
    • P2R3B_HUMAN
    • PP2A B'' subunit PR48
    • PP2A subunit B isoform PR48
    • PP2A subunit B PR48 isoform
    • PPP2R3B
    • PPP2R3L
    • PPP2R3LY
    • PR 48
    • PR48
    • Protein phosphatase 2 (formerly 2A) regulatory subunit B'' beta
    • Protein phosphatase 2 regulatory subunit B'' beta
    • Protein phosphatase 2A 48 kDa regulatory subunit
    • Serine/threonine protein phosphatase 2A 48kDa regulatory subunit B
    • Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
    see all
  • Function
    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Sequence similarities
    Contains 1 EF-hand domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162160 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up