Recombinant Human PPP2R3C protein (ab162929)

Overview

  • Product name
    Recombinant Human PPP2R3C protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTN EFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLW FLLDKHQTPPMIGEEAMINYENFLKVGEKAGAKCKQFFTAKVFAKLLHTD SYGRISIMQFFNYVMRKVWLHQTRIGLSLYDVAGQGYLRESDLENYILEL IPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLD DLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIF KLLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKP KDPLKISLQDLINSNQGDTVTTILIDLNGFWTYENREALVANDSENSADL DDT
    • Amino acids
      1 to 453
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C14orf10
    • Chromosome 14 open reading frame 10
    • G4-1
    • G5pr
    • Hypothetical protein FLJ20644
    • P2R3C_HUMAN
    • ppp2r3c
    • protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma
    • Protein phosphatase 2 regulatory subunit B''gamma
    • protein phosphatase 2, regulatory subunit B'', gamma
    • Protein phosphatase subunit G5PR
    • rhabdomyosarcoma antigen MU-RMS-40.6A
    • Rhabdomyosarcoma antigen MU-RMS-40.6A/6C
    • rhabdomyosarcoma antigen Mu-RMS-40.6C
    • serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
    see all
  • Function
    May regulate MCM3AP phosphorylation through phosphatase recruitment. May play a role in the activation-induced cell death of B-cells.
  • Tissue specificity
    Ubiquitously expressed in brain and other tissues.
  • Sequence similarities
    Contains 2 EF-hand domains.
  • Developmental stage
    Expressed in fetal brain.
  • Cellular localization
    Nucleus. Cytoplasm. Excluded from the nucleoli. Localization is cell cycle-dependent. Localizes to the cytoplasm during cytokinesis.
  • Information by UniProt

Images

  • ab162929 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up