Recombinant Human PPP2R5A protein (ab114910)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15172
    • SpeciesHuman
    • SequenceMSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQ AELHPLPQLKDATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRAT LNELVEYVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEP TLEASWPHIQLVYEFFLRFLESPDFRPSIAKRYIDQKFVQQLLELFDSED PRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYETEHFNGVAELL EILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEE PLFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENINKILPIMFASLY KISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYKAERQREKKKELE REELWKKLEELKLKKALEKQNSAYNMHSILSNTSAE
    • Molecular weight80 kDa including tags
    • Amino acids1 to 486

Specifications

Our Abpromise guarantee covers the use of ab114910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2A5A_HUMAN
    • B56A
    • MGC131915
    • PP2A B subunit B' alpha isoform
    • PP2A B subunit B56 alpha isoform
    • PP2A B subunit isoform B''-alpha
    • PP2A B subunit isoform B56-alpha
    • PP2A B subunit isoform PR61-alpha
    • PP2A B subunit isoform R5-alpha
    • PP2A B subunit PR61 alpha isoform
    • PP2A B subunit R5 alpha isoform
    • PPP2R5A
    • PR61A
    • PR61alpha
    • Protein phosphatase 2 regulatory subunit B (B56) alpha isoform
    • Protein phosphatase 2 regulatory subunit B' alpha
    • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
    see all
  • FunctionThe B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Tissue specificityWidely expressed with the highest expression in heart and skeletal muscle.
  • Sequence similaritiesBelongs to the phosphatase 2A regulatory subunit B56 family.
  • Post-translational
    modifications
    Phosphorylated on serine residues.
  • Cellular localizationCytoplasm. Nucleus. Chromosome > centromere. From mitotic prophase to metaphase, localizes at the inner centromere between a pair of sister kinetochores. Decreased expression at the onset of anaphase.
  • Information by UniProt

Recombinant Human PPP2R5A protein images

  • 12.5% SDS-PAGE showing ab114910 at approximately 79.57kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PPP2R5A protein (ab114910)

ab114910 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"