Recombinant Human PPP2R5D protein (ab114547)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQS QPPSSNKRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNREL QKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLN EMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDE PTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSE DPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQF LEKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVM EPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPAL YRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMK EREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRT VETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE AL
    • Molecular weight
      92 kDa including tags
    • Amino acids
      1 to 602

Specifications

Our Abpromise guarantee covers the use of ab114547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2A5D_HUMAN
    • B'delta
    • B56D
    • Delta isoform of regulatory subunit B56, protein phosphatase 2A
    • MGC2134
    • MGC8949
    • OTTHUMP00000039821
    • PP2A B subunit B' delta isoform
    • PP2A B subunit B56 delta isoform
    • PP2A B subunit isoform B''-delta
    • PP2A B subunit isoform B56-delta
    • PP2A B subunit isoform PR61-delta
    • PP2A B subunit isoform R5-delta
    • PP2A B subunit PR61 delta isoform
    • PP2A B subunit R5 delta isoform
    • PPP2R5D
    • Protein phosphatase 2 regulatory subunit B (B56) delta isoform
    • Protein phosphatase 2 regulatory subunit B delta isoform
    • Protein phosphatase 2 regulatory subunit B' delta
    • Serine threonine protein phosphatase 2A 56 kDa regulatory subunit delta isoform
    • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
    • TEG-271
    • Tex271
    see all
  • Function
    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Tissue specificity
    Isoform Delta-2 is widely expressed. Isoform Delta-1 is highly expressed in brain.
  • Sequence similarities
    Belongs to the phosphatase 2A regulatory subunit B56 family.
  • Cellular localization
    Cytoplasm. Nucleus. Nuclear in interphase, nuclear during mitosis.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114547

References

ab114547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114547.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up