Recombinant Human PPP2R5D protein (ab114548)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14738
    • SpeciesHuman
    • SequenceRLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIK KEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL
    • Molecular weight35 kDa including tags
    • Amino acids514 to 602

Specifications

Our Abpromise guarantee covers the use of ab114548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2A5D_HUMAN
    • B'delta
    • B56D
    • Delta isoform of regulatory subunit B56, protein phosphatase 2A
    • MGC2134
    • MGC8949
    • OTTHUMP00000039821
    • PP2A B subunit B' delta isoform
    • PP2A B subunit B56 delta isoform
    • PP2A B subunit isoform B''-delta
    • PP2A B subunit isoform B56-delta
    • PP2A B subunit isoform PR61-delta
    • PP2A B subunit isoform R5-delta
    • PP2A B subunit PR61 delta isoform
    • PP2A B subunit R5 delta isoform
    • PPP2R5D
    • Protein phosphatase 2 regulatory subunit B (B56) delta isoform
    • Protein phosphatase 2 regulatory subunit B delta isoform
    • Protein phosphatase 2 regulatory subunit B' delta
    • Serine threonine protein phosphatase 2A 56 kDa regulatory subunit delta isoform
    • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
    • TEG-271
    • Tex271
    see all
  • FunctionThe B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Tissue specificityIsoform Delta-2 is widely expressed. Isoform Delta-1 is highly expressed in brain.
  • Sequence similaritiesBelongs to the phosphatase 2A regulatory subunit B56 family.
  • Cellular localizationCytoplasm. Nucleus. Nuclear in interphase, nuclear during mitosis.
  • Information by UniProt

Recombinant Human PPP2R5D protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114548.

References for Recombinant Human PPP2R5D protein (ab114548)

ab114548 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"