Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP60510
    • SpeciesHuman
    • SequenceGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCG NVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL
    • Molecular weight36 kDa including tags
    • Amino acids218 to 307

Specifications

Our Abpromise guarantee covers the use of ab114693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PP X
    • PP-X
    • Pp4
    • PP4C
    • PP4C_HUMAN
    • PPH3
    • PPP4
    • ppp4c
    • PPX
    • protein phosphatase 4 (formerly X), catalytic subunit
    • Protein phosphatase 4 catalytic subunit
    • Protein phosphatase X
    • protein phosphatase X, catalytic subunit
    • Serine/threonine protein phosphatase 4 catalytic subunit
    • Serine/threonine-protein phosphatase 4 catalytic subunit
    see all
  • FunctionProtein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, DNA repair, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration. The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation and regulation of HDAC3. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on Ser-140 (gamma-H2AFX) generated during DNA replication and required for DNA double strand break repair. Dephosphorylates NDEL1 at CDK1 phosphorylation sites and negatively regulates CDK1 activity in interphase (By similarity). In response to DNA damage, catalyzes RPA2 dephosphorylation, an essential step for DNA repair since it allows the efficient RPA2-mediated recruitment of RAD51 to chromatin.
  • Sequence similaritiesBelongs to the PPP phosphatase family. PP-4 (PP-X) subfamily.
  • Cellular localizationCytoplasm. Nucleus. Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Recombinant Human PPP4C protein images

  • 12.5% SDS-PAGE showing ab114693 at approximately 35.53 kDa stained with Coomassie Blue.

References for Recombinant Human PPP4C protein (ab114693)

ab114693 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"