Overview

  • Product nameRecombinant Human PPP6C protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00743
    • SpeciesHuman
    • SequenceMAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTV CGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDSGYYSLETFTYLLALK AKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVLDMLT VAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPE DVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDE KLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTT TPYFL
    • Molecular weight59 kDa including tags
    • Amino acids1 to 305

Specifications

Our Abpromise guarantee covers the use of ab116916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ92648
    • MGC12249
    • PP 6
    • PP6
    • PP6C
    • PPP 6
    • PPP 6C
    • PPP6
    • PPP6_HUMAN
    • Ppp6c
    • Protein phosphatase 6 catalytic subunit
    • Serine/threonine protein phosphatase 6
    • Serine/threonine protein phosphatase catalytic subunit
    • Serine/threonine-protein phosphatase 6 catalytic subunit
    see all
  • FunctionCatalytic subunit of protein phospatase 6 (PP6). PP6 is a component of a signaling pathway regulating cell cycle progression in response to IL2 receptor stimulation. N-terminal domain restricts G1 to S phase progression in cancer cells, in part through control of cyclin D1. Downregulates MAP3K7 kinase activation of the IL1 signaling pathway by dephosphorylation of MAP3K7.
  • Tissue specificityUbiquitously expressed in all tissues tested with highest expression levels in testis, heart, kidney, brain, stomach, liver and skeletal muscle and lowest in placenta, lung colon and spleen.
  • Sequence similaritiesBelongs to the PPP phosphatase family. PP-6 (PP-V) subfamily.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human PPP6C protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116916 at approximately 59.29 kDa.

References for Recombinant Human PPP6C protein (ab116916)

ab116916 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"