Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEME EQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS
    • Amino acids
      203 to 302
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf8
    • Lysosomal thioesterase PPT2
    • Palmitoyl protein hydrolase 2
    • Palmitoyl protein thioesterase 2
    • PPT 2
    • PPT-2
    • Ppt2
    • PPT2_HUMAN
    • S thioesterase G14
    • S-thioesterase G14
    • VE statin2
    see all
  • Function
    Removes thioester-linked fatty acyl groups from various substrates including S-palmitoyl-CoA. Has the highest S-thioesterase activity for the acyl groups palmitic and myristic acid followed by other short- and long-chain acyl substrates. However, because of structural constraints, is unable to remove palmitate from peptides or proteins.
  • Tissue specificity
    Broadly expressed, with highest levels in skeletal muscle.
  • Sequence similarities
    Belongs to the palmitoyl-protein thioesterase family.
  • Cellular localization
    Lysosome.
  • Information by UniProt

Images

  • ab160459 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160459 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up