Overview

  • Product name
    Recombinant Human PPWD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAESGSDFQQRRRRRRDPEEPEKTELSERELAVAVAVSQENDEENEERW VGPLPVEATLAKKRKVLEFERVYLDNLPSASMYERSYMHRDVITHVVCTK TDFIITASHDGHVKFWKKIEEGIEFVKHFRSHLGVIESIAVSSEGALFCS VGDDKAMKVFDVVNFDMINMLKLGYFPGQCEWIYCPGDAISSVAASEKST GKIFIYDGRGDNQPLHIFDKLHTSPLTQIRLNPVYKAVVSSDKSGMIEYW TGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSVCFSPDGKKIATIGS DRKVRIFRFVTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVEREL EKVDAVRLINIVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRV MQLALFQGIAKKHRAATTIEMKASENPVLQNIQADPTIVCTSFKKNRFYM FTKREPEDTKSADSDRDVFNEKPSKEEVMAATQAEGPKRVSDSAIIHTSM GDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGT GMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTP WLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITVK
    • Amino acids
      1 to 646
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4632422M10Rik
    • A330090G21Rik
    • KIAA0073
    • OTTHUMP00000161887
    • Peptidylprolyl isomerase domain and WD repeat containing 1
    • Peptidylprolyl isomerase domain and WD repeat containing protein 1
    • Peptidylprolyl isomerase domain and WD repeat-containing protein 1
    • PPWD 1
    • Ppwd1
    • PPWD1_HUMAN
    • RGD1310204
    • Spliceosome-associated cyclophilin
    see all
  • Function
    Putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family. PPIL1 subfamily.
    Contains 1 PPIase cyclophilin-type domain.
    Contains 4 WD repeats.
  • Cellular localization
    Nucleus. Associated with spliceosomal complexes.
  • Information by UniProt

Images

  • ab161627 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161627 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161627.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up