Overview

  • Product name
    Recombinant Human PR285 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GVAVSSITKSQGSEWRYVLVSTVRTCAKSDLDQRPTKSWLKKFLGFVVDP NQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLLDFCEAQQTLVPAGQVRV CRRPTM
    • Amino acids
      1973 to 2078
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP-dependent helicase PRIC285
    • KIAA1769
    • PDIP1
    • Peroxisomal proliferator-activated receptor A-interacting complex 285 kDa protein
    • PPAR-alpha-interacting complex protein 285
    • PPAR-gamma DBD-interacting protein 1
    • PPAR-gamma DNA-binding domain-interacting protein 1
    • PR285_HUMAN
    • PRIC285
    • PRPF8
    see all
  • Function
    Helicase that acts as a transcriptional coactivator for a number of nuclear receptors including PPARA, PPARG, THRA, THRB and RXRA.
  • Tissue specificity
    Expressed in various tissues including heart, pancreas, skeletal muscle, colon, spleen, liver, kidney, lung, peripheral blood and placenta.
  • Sequence similarities
    Belongs to the DNA2/NAM7 helicase family.
    Contains 1 C2H2-type zinc finger.
  • Domain
    Contains 5 Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs. These motifs are not required for interaction with PPARG.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164757 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up