Overview

  • Product name
    Recombinant Human PRAF1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDST NPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQME VYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRA LNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYL PPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEEN SHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGP GVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDF QIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRRVSVAAGSEEDHKLGTLS LPLPPAQTSDRLAKRRKIT
    • Amino acids
      1 to 419
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A49
    • DNA directed RNA polymerase I subunit RPA49
    • DNA-directed RNA polymerase I subunit E
    • DNA-directed RNA polymerase I subunit RPA49
    • FLJ 13390
    • FLJ13970
    • PAF53
    • POLR 1 E
    • POLR1E
    • Polymerase (RNA) I associated factor 1
    • Polymerase (RNA) I polypeptide E
    • Polymerase (RNA) I polypeptide E, 53kDa
    • PRAF1
    • RNA polymerase I associated factor 1
    • RNA polymerase I associated factor 53
    • RNA polymerase I polypeptide E
    • RNA polymerase I subunit A49
    • RNA polymerase I-associated factor 1
    • RNA polymerase I-associated factor 53
    • RP11405L18.3
    • RPA49_HUMAN
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.
  • Sequence similarities
    Belongs to the eukaryotic RPA49/POLR1E RNA polymerase subunit family.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab163839 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up