Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEA WKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHES Q
    • Amino acids
      371 to 471
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MAP kinase-activated protein kinase 5
    • MAPK-activated protein kinase 5
    • MAPK5_HUMAN
    • MAPKAP kinase 5
    • MAPKAPK-5
    • MAPKAPK5
    • Mitogen activated protein kinase activated protein kinase 5
    • p38-regulated/activated protein kinase
    • PRAK
    see all
  • Function
    Mediates stress-induced small heat shock protein 27 phosphorylation.
  • Tissue specificity
    Expressed ubiquitously.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated on Thr-182; which is the regulatory phosphorylation site and is located on the T-loop/loop 12.
  • Cellular localization
    Cytoplasm. Nucleus. Also observed in the nucleus.
  • Information by UniProt

Images

  • ab160090 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up