Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP42785
    • SpeciesHuman
    • SequenceMGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSV LYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFC NNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQA LADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGAL AASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNT GSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETA TSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGV RPRPSWITTMYGGKNISSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTI SEGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYDSAGKQH
    • Molecular weight81 kDa including tags
    • Amino acids1 to 496

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Angiotensinase C
    • HUMPCP
    • Lysosomal carboxypeptidase C
    • Lysosomal Pro X carboxypeptidase
    • Lysosomal Pro-X carboxypeptidase
    • MGC2202
    • PCP
    • PCP_HUMAN
    • PRCP
    • Proline carboxypeptidase
    • Prolylcarboxypeptidase
    • Prolylcarboxypeptidase (angiotensinase C)
    • prolylcarboxypeptidase isoform 1 preproprotein
    see all
  • FunctionCleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.
  • Tissue specificityHighest levels in placenta, lung and liver. Also present in heart, brain, pancreas and kidney.
  • Sequence similaritiesBelongs to the peptidase S28 family.
  • Cellular localizationLysosome.
  • Information by UniProt

Recombinant Human PRCP protein images

  • 12.5% SDS-PAGE showing ab116920 at approximately 80.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PRCP protein (ab116920)

ab116920 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"