Recombinant Human PRDM4/PFM1 protein (ab153158)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELL FYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQG
    • Amino acids
      476 to 575
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC45046
    • PFM 1
    • PFM1
    • PR domain containing 4
    • PR domain containing protein 4
    • PR domain zinc finger protein 4
    • PR domain zinc finger protein PFM 1
    • PR domain-containing protein 4
    • PR/SET domain 4
    • PRDM 4
    • PRDM4
    • PRDM4_HUMAN
    see all
  • Function
    May function as a transcription factor involved in cell differentiation.
  • Tissue specificity
    Expressed in many tissues. Highly expressed in ovary, testis, pancreas, brain, heart and prostate.
  • Sequence similarities
    Contains 6 C2H2-type zinc fingers.
    Contains 1 SET domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153158 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up