Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRRRAPELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQL ELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQ QGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTD FSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIE DLALGPDGKLVTVGRDLKASVWQKDQLVTQLHWQENGPTFSSTPYRYQAC RFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCGH EVVSCLDVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVA FLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCVG LIIVTILLLQSAFPGFL
    • Amino acids
      1 to 417
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Mammalian guanine nucleotide exchange factor mSec12
    • Preb
    • PREB_HUMAN
    • Prolactin regulatory binding element protein
    • Prolactin regulatory element binding
    • Prolactin regulatory element binding protein
    • Prolactin regulatory element-binding protein
    • SEC12
    see all
  • Function
    Was first identified based on its probable role in the regulation of pituitary gene transcription. Binds to the prolactin gene (PRL) promoter and seems to activate transcription (By similarity). Guanine nucleotide exchange factor that activates SARA2. Required for the formation of COPII transport vesicles from the ER.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 3 WD repeats.
  • Cellular localization
    Nucleus. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab160825 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up