Recombinant Human Pregnancy specific beta 1 glycoprotein 11 (ab117041)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MHAAEIMGPLSAPPCTEHIKWKGLLLTVETPKPSISSSNLNPREAMETVI LTCNPETPDASYLWWMNGQSLPMTHRMQLSETNRTLFLFGVTKYTAGPYE CEIWNSGSASRSDPVTLNLLHGPDLPRIFPSVTSYYSGENLDLSCFADSN PPAQYSWTINGKFQLSGQKLFIPQITPKHNGLYACSARNSATGEESSTSL TIRVIAPPGLGTFAFNNPT
    • Molecular weight
      50 kDa including tags
    • Amino acids
      1 to 219

Specifications

Our Abpromise guarantee covers the use of ab117041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC22484
    • OTTHUMP00000200192
    • OTTHUMP00000200193
    • OTTHUMP00000200194
    • Pregnancy specific beta 1 glycoprotein 13
    • Pregnancy-specific beta-1-glycoprotein 11
    • Pregnancy-specific beta-1-glycoprotein 13
    • Pregnancy-specific glycoprotein 11
    • Pregnancy-specific glycoprotein 13
    • PS-beta-G-11
    • PS-beta-G-13
    • PSBG 11
    • PSBG 13
    • PSBG-11
    • PSBG-13
    • PSBG11
    • PSBG13
    • PSG 11
    • PSG11
    • PSG11_HUMAN
    • PSG13
    • PSG14
    see all
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage
    PSBG are produced in high quantity during pregnancy.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Pregnancy specific beta 1 glycoprotein 11 images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117041 at approximately 50.16 kDa.

References for Recombinant Human Pregnancy specific beta 1 glycoprotein 11 (ab117041)

ab117041 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up