Recombinant Human Pregnancy specific beta 1 glycoprotein 11 (ab159256)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PRIFPSVTSYYSGENLDLSCFANSNPPAQYSWTINGKFQLSGQKLFIPQI TPKHNGLYACSARNSATGEESSTSLTIRVIAPPGLGTFAFNNPT
    • Amino acids
      126 to 219
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC22484
    • OTTHUMP00000200192
    • OTTHUMP00000200193
    • OTTHUMP00000200194
    • Pregnancy specific beta 1 glycoprotein 13
    • Pregnancy-specific beta-1-glycoprotein 11
    • Pregnancy-specific beta-1-glycoprotein 13
    • Pregnancy-specific glycoprotein 11
    • Pregnancy-specific glycoprotein 13
    • PS-beta-G-11
    • PS-beta-G-13
    • PSBG 11
    • PSBG 13
    • PSBG-11
    • PSBG-13
    • PSBG11
    • PSBG13
    • PSG 11
    • PSG11
    • PSG11_HUMAN
    • PSG13
    • PSG14
    see all
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage
    PSBG are produced in high quantity during pregnancy.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159256 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up