Recombinant Human Pregnancy Specific Glycoprotein 1 (ab114940)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP11464
    • SpeciesHuman
    • SequenceQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRDLYHYITSYVV DGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGV TGRFTFTLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNG QSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLN LLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSP RVRRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDL PRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHI TTKHSGLYVCSVRNSATGKESSKSMTVEVSGKWIPASLAIGF
    • Molecular weight69 kDa including tags
    • Amino acids35 to 426

Specifications

Our Abpromise guarantee covers the use of ab114940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B1G1
    • Carcinoembryonic antigen SG8
    • CD66 antigen-like family member F
    • CD66f
    • CD66f antigen
    • CEA
    • DHFRP2
    • Fetal liver non-specific cross-reactive antigen 1/2
    • FL-NCA-1/2
    • PBG 1
    • PBG1
    • Pregnancy specific B 1 glycoprotein
    • Pregnancy specific beta 1 glycoprotein
    • Pregnancy specific beta 1 glycoprotein 1
    • Pregnancy specific beta 1 glycoprotein 2
    • Pregnancy specific beta 1 glycoprotein 7
    • Pregnancy specific beta 1 glycoprotein 8
    • Pregnancy specific beta 1 glycoprotein C/D
    • Pregnancy-specific beta-1 glycoprotein C/D
    • Pregnancy-specific beta-1-glycoprotein 1
    • Pregnancy-specific glycoprotein 1
    • PS beta C/D
    • PS-beta-C/D
    • PS-beta-G-1
    • PSBG 1
    • PSBG 2
    • PSBG-1
    • PSBG1
    • PSBG2
    • PSG 1
    • PSG 2
    • PSG 8
    • PSG 95
    • PSG IIA d
    • PSG1
    • PSG1_HUMAN
    • PSG2
    • PSG8
    • PSG95
    • PSGGA
    • PSGGB
    • PSGIIA
    • PSGIIA a
    • PSGIIA b
    • PSGIIA c
    • SP 1
    • SP1
    see all
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stagePSBG are produced in high quantity during pregnancy.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Pregnancy Specific Glycoprotein 1 images

  • ab114940 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Pregnancy Specific Glycoprotein 1 (ab114940)

ab114940 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"