Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQ ICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPP
    • Molecular weight
      35 kDa including tags
    • Amino acids
      281 to 365

Specifications

Our Abpromise guarantee covers the use of ab114793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 55 kDa leucine rich repeat protein of articular cartilage
    • MST161
    • MSTP161
    • Prelp
    • PRELP_HUMAN
    • Prolargin
    • Prolargin proteoglycan
    • Proline arginine rich end leucine rich repeat protein
    • Proline-arginine-rich end leucine-rich repeat protein
    • Proline/arginine rich end leucine rich repeat protein
    • SLRR2A
    see all
  • Function
    May anchor basement membranes to the underlying connective tissue.
  • Tissue specificity
    Connective tissue.
  • Sequence similarities
    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 12 LRR (leucine-rich) repeats.
  • Domain
    The basic amino-terminal Arg/Pro-rich binds heparin and heparan sulfate. Binds collagens type I and type II through its leucine-rich repeat domain.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Recombinant Human PRELP protein images

  • ab114793 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human PRELP protein (ab114793)

ab114793 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up