Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP51888
    • SpeciesHuman
    • SequenceRGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQ ICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPP
    • Molecular weight35 kDa including tags
    • Amino acids281 to 365

Specifications

Our Abpromise guarantee covers the use of ab114793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 55 kDa leucine rich repeat protein of articular cartilage
    • MST161
    • MSTP161
    • Prelp
    • PRELP_HUMAN
    • Prolargin
    • Prolargin proteoglycan
    • Proline arginine rich end leucine rich repeat protein
    • Proline-arginine-rich end leucine-rich repeat protein
    • Proline/arginine rich end leucine rich repeat protein
    • SLRR2A
    see all
  • FunctionMay anchor basement membranes to the underlying connective tissue.
  • Tissue specificityConnective tissue.
  • Sequence similaritiesBelongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 12 LRR (leucine-rich) repeats.
  • DomainThe basic amino-terminal Arg/Pro-rich binds heparin and heparan sulfate. Binds collagens type I and type II through its leucine-rich repeat domain.
  • Cellular localizationSecreted > extracellular space > extracellular matrix.
  • Information by UniProt

Recombinant Human PRELP protein images

  • ab114793 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human PRELP protein (ab114793)

ab114793 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"