Recombinant Human PRH1 + PRH2 protein (ab159184)

Overview

  • Product name
    Recombinant Human PRH1 + PRH2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPP LGGQQSQPSAGDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGH PPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPP PQGGRPQGPPQGQSPQ
    • Amino acids
      1 to 166
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PRH1
    • Db-s
    • DKFZp686B01256
    • DKFZp686F14256
    • DKFZp686I11251
    • DKFZp686J06255
    • DKFZp686L01253
    • DKFZp686L16244
    • DKFZp686M04243
    • DKFZp686N24248
    • Pa
    • Parotid acidic protein
    • Parotid double-band protein
    • Parotid isoelectric focusing variant protein
    • Parotid proline-rich protein 1/2
    • PIF-S
    • Pr1/Pr2
    • PRH2
    • Protein C
    • PRP-1/PRP-2
    • Salivary acidic proline-rich phosphoprotein 1/2
    see all
  • Relevance
    PRP's act as highly potent inhibitors of crystal growth of calcium phosphates. They provide a protective and reparative environment for dental enamel which is important for the integrity of the teeth.
  • Cellular localization
    Secreted

Images

  • ab159184 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up