Overview

  • Product name
    Recombinant Human PRH1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSQDLNEDVSQEDVPLVISDGGDSEQFLD EERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQG PPQQGGHPPPPQGRPQGPPQQGGHPRPPR
    • Molecular weight
      13 kDa including tags
    • Amino acids
      17 to 122
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    ab167837 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Db-F
    • Db-s
    • PA
    • Parotid acidic protein
    • Parotid double-band protein
    • Parotid isoelectric focusing variant protein
    • Parotid proline-rich protein 1/2
    • Peptide P-C
    • PIF-F
    • PIF-S
    • Pr1/Pr2
    • PRH2
    • proline-rich protein HaeIII subfamily 1
    • Protein A
    • Protein C
    • PRP-1/PRP-2
    • PRP-3/PRP-4
    • PRPC_HUMAN
    • Salivary acidic proline-rich phosphoprotein 1/2
    • Salivary acidic proline-rich phosphoprotein 3/4
    see all
  • Function
    PRP's act as highly potent inhibitors of crystal growth of calcium phosphates. They provide a protective and reparative environment for dental enamel which is important for the integrity of the teeth.
  • Post-translational
    modifications
    Proteolytically cleaved; PRP-2, PRP-1, PIF-S and Db-S yield PRP-4, PRP-3 (protein A), PIF-F and Db-F, respectively.
    An hexuronic acid was shown to be linked to Ser-33 in about 40% of the polypeptides. Neither the structure of the carbohydrate (whether glucuronic acid or an isomer of), nor the linkage (whether a glycoside or an ester) has been definitely established.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab167837 (3 µg).

References

ab167837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up