Recombinant Human PRKCDBP protein (ab164974)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRESALEPGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQ GGLAGSVRRIQSGLGALSRSHDTTSNTLAQLLAKAERVSSHANAAQERAV RRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQ SELGPEQLEAEVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPA APPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAA EEALLQMESVA
    • Amino acids
      1 to 261
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cavin 3
    • Cavin-3
    • CAVIN3
    • hSRBC
    • MGC20400
    • PRDBP_HUMAN
    • Prkcdbp
    • Protein kinase C delta binding protein
    • Protein kinase C delta-binding protein
    • Sdr related gene product that binds to c kinase
    • Serum deprivation response factor related gene product that binds to C kinase
    • Serum deprivation response factor-related gene product that binds to C-kinase
    • SRBC
    see all
  • Function
    Plays a role in the regulation of the circadian clock. Modulates the period length and phase of circadian gene expression and also regulates expression and interaction of the core clock components PER1/2 and CRY1/2. Seems to have an immune potentiation function.
  • Tissue specificity
    Strongly expressed in mammary and epithelial cells.
  • Sequence similarities
    Belongs to the PTRF/SDPR family.
  • Post-translational
    modifications
    In vitro, phosphorylated by PRKCD.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164974 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164974 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up