Recombinant Human PRKRIR protein (ab159224)

Overview

  • Product name
    Recombinant Human PRKRIR protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPST IYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNT LTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
    • Amino acids
      1 to 150
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 52 kDa repressor of the inhibitor of the protein kinase
    • 58 kDa interferon induced protein kinase interacting protein
    • DAP4
    • Death associated protein 4
    • Inhibitor of protein kinase PKR
    • Interferon inducible double stranded RNA dependent inhibitor
    • MGC102750
    • P52rIPK
    • P58 repressor
    • p58IPK interacting protein
    • THAP domain containing protein 0
    • THAP0
    see all
  • Relevance
    PRKRIR is upstream regulator of interferon induced serine/threonine protein kinase R (PKR). It may block the PKR inhibitory function of P58IPK, resulting in the restoration of kinase activity and suppression of cell growth.
  • Cellular localization
    Nucleus

Images

  • ab159224 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up