Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP51817
    • SpeciesHuman
    • SequenceFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKP PIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
    • Molecular weight36 kDa including tags
    • Amino acids269 to 358

Specifications

Our Abpromise guarantee covers the use of ab114807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PKX1
    • PRKX
    • PRKX_HUMAN
    • Protein kinase PKX1
    • Serine/threonine-protein kinase PRKX
    see all
  • Tissue specificityHigh levels in adult and fetal brain, kidney and lung; low levels in adult placenta, heart, liver, skeletal muscle, pancreas and fetal liver.
  • Involvement in diseaseNote=A chromosomal aberration involving PRKX is a cause of sex reversal disorder. Translocation t(X;Y)(p22;p11) with PRKY. Chromosomal translocations proximal to PRKY account for about 30% of the cases of sex reversal disorder in XX males and XY females.
  • Sequence similaritiesBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
  • Information by UniProt

Recombinant Human PRKX protein images

  • 12.5% SDS-PAGE showing ab114807 at approximately 35.53kDa stained with Coomassie Blue.

References for Recombinant Human PRKX protein (ab114807)

ab114807 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"