Recombinant human PRMT1 protein (Active) (ab198122)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKD YYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGI LCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVEL PVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVT AIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACL IKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGF STSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTI DLDFKGQLCELSCSTDYRMR
    • Molecular weight
      68 kDa including tags
    • Amino acids
      2 to 371
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 6.2 pmol/min/µg.
    Assay Conditions: 50 µl reaction mix (20 mM phosphate buffer pH 7.4, 20 µM S-adenosyl methionine, and 1-5 ng ab198122 add to the wells coated with the substrate. Incubate at room temperature for 1 hr. Add antibody against methylated R3 residue of histone H4, incubate 1 hr. Add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminescent substrates and read luminesence.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >= 68 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 1.74% Sodium chloride, 20% Glycerol, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • ANM 1
    • ANM1
    • ANM1_HUMAN
    • HCP 1
    • HCP1
    • Heterogeneous nuclear ribonucleoprotein methyltransferase 1 like 2
    • Heterogeneous nuclear ribonucleoproteins methyltransferase like 2
    • Heterogeneous nuclear ribonucleoproteins methyltransferase like2
    • Histone-arginine N-methyltransferase PRMT1
    • HMT 2
    • HMT1 (hnRNP methyltransferase S. cerevisiae) like 2
    • HMT1 hnRNP methyltransferase
    • HMT1 hnRNP methyltransferase like 2
    • HMT1 hnRNP methyltransferase like 2 (S. cerevisiae)
    • HMT2
    • HRMT1 L2
    • HRMT1L 2
    • HRMT1L2
    • Human mRNA for suppressor for yeast mutant
    • Human mRNA for suppressor for yeast mutant complete cds
    • Interferon receptor 1 bound protein 4
    • Interferon receptor 1 bound protein4
    • Interferon receptor 1-bound protein 4
    • Interferon receptor 1bound protein 4
    • IR1 B4
    • IR1B 4
    • IR1B4
    • Mrmt 1
    • Mrmt1
    • PRMT 1
    • PRMT1
    • Protein arginine methyltransferase 1
    • Protein arginine N methyltransferase 1
    • Protein arginine N methyltransferase1
    • Protein arginine N-methyltransferase 1
    • R1B4
    • S. cerevisiae like 2
    see all
  • Function
    Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in proteins such as ESR1, histone H2, H3 and H4, PIAS1, HNRNPA1, HNRNPD, NFATC2IP, SUPT5H, TAF15 and EWS. Constitutes the main enzyme that mediates monomethylation and asymmetric dimethylation of histone H4 'Arg-4' (H4R3me1 and H4R3me2a, respectively), a specific tag for epigenetic transcriptional activation. Together with dimethylated PIAS1, represses STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling. May be involved in the regulation of TAF15 transcriptional activity, act as an activator of estrogen receptor (ER)-mediated transactivation, play a key role in neurite outgrowth and act as a negative regulator of megakaryocytic differentiation, by modulating p38 MAPK pathway.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the protein arginine N-methyltransferase family.
  • Cellular localization
    Nucleus. Cytoplasm > cytosol.
  • Information by UniProt

Images

  • Activity assay using ab198122.

  • 10% SDS-PAGE analysis of 1.5 µg ab198122 with Coomassie staining.

References

ab198122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up