Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFCSLASGATGGRGAVENEEDLP ELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQ FNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLK PVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSA EAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFS SYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMF AAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEK VDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSD VNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHI DCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTG PQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLN NSTQTYGLQ
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 531
    • Tags
      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169920 was expressed in E. coli as inclusion bodies, refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris-HCl buffer
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • 2010005E20Rik
    • 2410018A17Rik
    • AL033309
    • ANM3_HUMAN
    • Heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 3
    • Heterogeneous nuclear ribonucleoprotein methyltransferase like 3
    • Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 3
    • Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3
    • HMT1 hnRNP methyltransferase like 3
    • HMT1 hnRNP methyltransferase like 3 S. cerevisiae
    • HMT1-like 3
    • hnRNP methyltransferase like 3
    • HRMT1L3
    • PRMT 3
    • PRMT3
    • Protein arginine methyltransferase 3
    • Protein arginine N methyltransferase 3
    • Protein arginine N-methyltransferase 3
    see all
  • Function
    Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.
  • Sequence similarities
    Belongs to the protein arginine N-methyltransferase family.
    Contains 1 C2H2-type zinc finger.
  • Domain
    The zinc-finger is responsible for substrate specificity.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab169920 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up