Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECY SDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCA QAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDA IVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQML EWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQ RFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGES EKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPR RLRVLLRYKVGDQEEKTKDFAMED
    • Molecular weight
      43 kDa including tags
    • Amino acids
      2 to 375
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Genbank accession no.: NM_018137

Specifications

Our Abpromise guarantee covers the use of ab196434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity 0.015 pmol/min/µg
    Assay Conditions: 50 µl reaction mix (20 mM phosphate buffer pH 7.4, 20 µM S-adenosylmethionine, and 1-5 ng methyltransferase PRMT6) is added to microwells coated with histone substrate. Incubate at 30°C for 2 hr. Add antibody against methylated Arg residue of histone H3, incubate 1 hr. Then, add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminescent substrates and read luminesence.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 45 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • ANM6_HUMAN
    • Chromobox protein homolog 7
    • FLJ10559
    • FLJ51477
    • Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 6
    • Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6
    • Histone-arginine N-methyltransferase PRMT6
    • HMT1 hnRNP methyltransferase like 6.
    • HRMT1L6
    • OTTHUMP00000012633
    • PRMT 6
    • prmt6
    • Protein arginine methyltransferase 6
    • Protein arginine N methyltransferase 6
    • Protein arginine N-methyltransferase 6
    see all
  • Function
    Arginine methyltransferase that can catalyze the formation of both omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA), with a strong preference for the formation of aDMA. Preferentially methylates arginyl residues present in a glycine and arginine-rich domain and displays preference for monomethylated substrates. Specifically mediates the asymmetric dimethylation of histone H3 'Arg-2' to form H3R2me2a. H3R2me2a represents a specific tag for epigenetic transcriptional repression and is mutually exclusive with methylation on histone H3 'Lys-4' (H3K4me2 and H3K4me3). Acts as a transcriptional repressor of various genes such as HOXA2, THBS1 and TP53. Repression of TP53 blocks cellular senescence (By similarity). Also methylates histone H2A and H4 'Arg-3' (H2AR3me and H4R3me, respectively). Acts as a regulator of DNA base excision during DNA repair by mediating the methylation of DNA polymerase beta (POLB), leading to the stimulation of its polymerase activity by enhancing DNA binding and processivity. Methylates HMGA1. Regulates alternative splicing events. Acts as a transcriptional coactivator of a number of steroid hormone receptors including ESR1, ESR2, PGR and NR3C1. Promotes fasting-induced transcriptional activation of the gluconeogenic program through methylation of the CRTC2 transcription coactivator. May play a role in innate immunity against HIV-1 in case of infection by methylating and impairing the function of various HIV-1 proteins such as Tat, Rev and Nucleocapsid protein p7 (NC).
  • Tissue specificity
    Highly expressed in kidney and testis.
  • Sequence similarities
    Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N-methyltransferase family. PRMT6 subfamily.
    Contains 1 SAM-dependent MTase PRMT-type domain.
  • Post-translational
    modifications
    Automethylation enhances its stability and antiretroviral activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of 3 μg of ab196434 on a 10% SDS-PAGE gel stained with Coomassie.

  • SDS-PAGE analysis of 2 μg of ab196434 on a 4-20% SDS-PAGE gel stained with Coomassie.

  • Specific activity of ab196434.

References

ab196434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up