Recombinant Human Probable hydrolase PNKD protein (ab161844)

Overview

  • Product name
    Recombinant Human Probable hydrolase PNKD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAVVAATALKSRGARNARVLRGILAGATANKVSHNRTRALQSHSSSEGK EEPEPLSPELEYIPRKRGKNPMKAVGLAWYSLYTRTWLGYLFYRQQLRRA RNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQAQLAVAVDPSD PRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDG IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLF SGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF AGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLAL QEALGPGPGPTGDDDYSRAQLLEELRRLKDMHKSK
    • Amino acids
      1 to 385
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2210013N15Rik
    • 2810403H05Rik
    • AI854243
    • BRAIN PROTEIN 17
    • BRP17
    • DYT8
    • FKSG19
    • FPD1
    • KIAA1184
    • KIPP1184
    • MNCb-5687
    • MR-1
    • MR1
    • Myofibrillogenesis regulator 1
    • Paroxysmal nonkinesiogenic dyskinesia protein
    • PDC
    • PKND1
    • Pnkd
    • PNKD_HUMAN
    • Probable hydrolase PNKD
    • TAHCCP2
    • Trans-activated by hepatitis C virus core protein 2
    see all
  • Function
    Probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B signaling pathway.
  • Tissue specificity
    Isoform 1 is only expressed in the brain. Isoform 2 is ubiquitously detected with highest expression in skeletal muscle and detected in myocardial myofibrils. Variant Val-7 and Val-9 are detected in the brain only.
  • Involvement in disease
    Defects in PNKD are the cause of dystonia type 8 (DYT8) [MIM:118800]. DYT8 is a paroxysmal non-kinesigenic dystonia/dyskinesia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT8 is characterized by attacks of involuntary movements brought on by stress, alcohol, fatigue or caffeine. The attacks generally last between a few seconds and four hours or longer. The attacks may begin in one limb and spread throughout the body, including the face.
  • Sequence similarities
    Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family.
  • Post-translational
    modifications
    Isoform 2 is phosphorylated at Ser-121 upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus; Mitochondrion and Membrane.
  • Information by UniProt

Images

  • ab161844 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up